PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa12g014470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 554aa    MW: 62595.7 Da    PI: 8.3713
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa12g014470.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B347.14.3e-15251001595
                     -EE--HHH.HTT..---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3  15 rlvlpkkfaeeh..ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                      l +p +f+ +h  g +  e+ t++l++  s   Wevk+     +gr + t+GWkeFv a++ + gD++vF+++g  +f ++v+
  Csa12g014470.1  25 YLNIPVTFFLKHlqGRN--EHETVKLRTeVSDTIWEVKI----EDGRRLTTDGWKEFVTAHDFRIGDVIVFRHEG--DFVFHVT 100
                     489*********85444..5569999996777*******....44445789*********************766..5644665 PP

2B353.93.4e-17158249599
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                      ++ ++l+++ +++p +f++++g  k+++ +++l +e grsW++ l ++k++ +++l+ GW++F++ang++ g   +Fkl++ +++++v++++++
  Csa12g014470.1 158 NVSVSNLQEDKVYVPLSFVRSNGWTKACG-KVVLLNEMGRSWNLSLDHDKSGIKTYLRHGWRSFCNANGMNRGGY-TFKLVK-NSGTPVIRLCQA 249
                     56678889999***********9999998.****************999*9999*******************96.***998.77779**99975 PP

3B374.41.3e-23268359698
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                     +++++++++ l+lpk f++++g++k +  +++l++e gr+W++ l++ k+ +++v+++GW++F++ ngLk++D++ Fkl++ +++++v+ ++ 
  Csa12g014470.1 268 LTPSSFNHDALYLPKGFVSSNGLDKDCCDEMVLKNEYGRTWNLVLRHHKSNNTVVMSRGWRSFCQGNGLKARDSFRFKLVR-TGAKPVLCLCP 359
                     4778888999********************************************************************998.88889999886 PP

4B345.31.5e-14453549199
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     f++ ++++++ +++ l+lp +f++ +g+kk++  ++tl  ++g    v+l  +   gr  l++ Wk+F++ + +k g+++v++l++++++++ +k
  Csa12g014470.1 453 FLTLTISPYSYRTNKLRLPLHFTRVNGIKKPG--KITLLGQDGVHRMVRLVKDHENGRLRLGRDWKGFCELHSVKIGESFVLELIWKKDASPALK 545
                     77888999******************999766..8***************99999999********************************9*999 PP

                     EE-S CS
              B3  96 vfrk 99 
                     ++ k
  Csa12g014470.1 546 FCTK 549
                     9965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.94E-208112IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.8E-208116IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.89911105IPR003340B3 DNA binding domain
CDDcd100178.08E-1412100No hitNo description
SMARTSM010193.3E-1714105IPR003340B3 DNA binding domain
PfamPF023624.3E-102698IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.3E-18148251IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.3E-17150254IPR015300DNA-binding pseudobarrel domain
CDDcd100176.17E-14154247No hitNo description
PROSITE profilePS5086312.083154250IPR003340B3 DNA binding domain
SMARTSM010191.8E-20155250IPR003340B3 DNA binding domain
PfamPF023622.9E-16157249IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.4E-21256359IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.61E-22259364IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.551263361IPR003340B3 DNA binding domain
CDDcd100177.08E-20263359No hitNo description
SMARTSM010191.9E-28264361IPR003340B3 DNA binding domain
PfamPF023621.0E-22268360IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.3E-15445539IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.1E-15447538IPR015300DNA-binding pseudobarrel domain
PfamPF023622.1E-14453549IPR003340B3 DNA binding domain
SMARTSM010192.5E-18453550IPR003340B3 DNA binding domain
CDDcd100179.04E-13453538No hitNo description
PROSITE profilePS5086311.138453550IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MADSGLQSPK NPHFFQALLP GFDSYLNIPV TFFLKHLQGR NEHETVKLRT EVSDTIWEVK  60
IEDGRRLTTD GWKEFVTAHD FRIGDVIVFR HEGDFVFHVT ALGLNCCEIE YTSSSHSIDD  120
DCDIHQDNIE IRPMKKRVKK NPRREDDSSS EHSCFVANVS VSNLQEDKVY VPLSFVRSNG  180
WTKACGKVVL LNEMGRSWNL SLDHDKSGIK TYLRHGWRSF CNANGMNRGG YTFKLVKNSG  240
TPVIRLCQAG CKPDAESSSN CSYFAGSLTP SSFNHDALYL PKGFVSSNGL DKDCCDEMVL  300
KNEYGRTWNL VLRHHKSNNT VVMSRGWRSF CQGNGLKARD SFRFKLVRTG AKPVLCLCPA  360
ETKRDTRVVE CSEGTDVDSL STDPSSGEES SETEESEVKK NTKHKGRDNI NFKEDSEVES  420
IEDKISLHEC SNIEKWKYCS RSGASSSSSQ SRFLTLTISP YSYRTNKLRL PLHFTRVNGI  480
KKPGKITLLG QDGVHRMVRL VKDHENGRLR LGRDWKGFCE LHSVKIGESF VLELIWKKDA  540
SPALKFCTKV NCV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010447536.10.0PREDICTED: B3 domain-containing protein REM17-like
TrEMBLR0F4H10.0R0F4H1_9BRAS; Uncharacterized protein
STRINGBra024697.1-P1e-160(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57811648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24645.11e-131B3 family protein